DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4080 and march4l

DIOPT Version :9

Sequence 1:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001038876.1 Gene:march4l / 100000640 ZFINID:ZDB-GENE-060825-323 Length:421 Species:Danio rerio


Alignment Length:235 Identity:60/235 - (25%)
Similarity:101/235 - (42%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELC--KFPFIMHTKIKPFNE 104
            :||||. :...|..||:||.||||::..|:.||.:|::...:.|||||  |:..|..:...|. :
Zfish   142 LCRICF-QGPEQGELLSPCRCSGSVRCTHEPCLIKWISERGSWSCELCYYKYQVIAISTKNPL-Q 204

  Fly   105 WRSLDISGIERRRLCYSVLFHCAAALCVIWSLCVLIERAADDVQRGLIDWPFWTKLA-------- 161
            |:::.::.||:.::..:||    .:|.:|.|                |.|..|:.|:        
Zfish   205 WQAISLTVIEKVQIAAAVL----GSLFLIAS----------------ISWLVWSSLSPSAKWQRQ 249

  Fly   162 ----VVTVGLTGGIVFMYIQCKAYL--------HLCHRWKARNRILLIQNAPEKIHPVAPPSPVA 214
                .:...:.|   ||.:.|.|.:        .:.:||:|.|:...:.|. :|:..........
Zfish   250 DLLFQICYAMYG---FMDLVCIALIVHEGPSVFRIFNRWQAVNQQWKVLNY-DKVKDNEDHQKTG 310

  Fly   215 AHHQHFSEPLAH-----------AGSTSGAVEINASGAAG 243
            |..:..|.||.|           :.|||..:...|:.|||
Zfish   311 ATFRTLSLPLTHRMGQSGPEGEPSTSTSSLMAAAAAAAAG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 22/49 (45%)
march4lNP_001038876.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..79
RINGv 143..188 CDD:128983 20/45 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..385 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.