DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and AT1G53540

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_175759.1 Gene:AT1G53540 / 841789 AraportID:AT1G53540 Length:157 Species:Arabidopsis thaliana


Alignment Length:171 Identity:41/171 - (23%)
Similarity:68/171 - (39%) Gaps:63/171 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLPNTLGLGRRR----------YSPYERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQF 99
            |:|:..| |||.          :.|:|.        ....||..||  ||         |||:.|
plant     3 LIPSIFG-GRRTNVFDPFSLDVFDPFEG--------FLTPSGLANA--PA---------MDVAAF 47

  Fly   100 -----------------------KPNELTVKVVD-NTVVVEG----KHEEREDGHGMIQR---HF 133
                                   :..|:.|:|.| |.:.:.|    ::||:.|....::|   .|
plant    48 TNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKF 112

  Fly   134 VRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKE-QAKS 173
            .|::.||:.....|:.::: .:|||::..|..|.|: :.||
plant   113 TRRFRLPENAKMEEIKASM-ENGVLSVTVPKVPEKKPEVKS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 22/107 (21%)
AT1G53540NP_175759.1 IbpA 11..156 CDD:223149 37/162 (23%)
ACD_ScHsp26_like 51..142 CDD:107229 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.