DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and AT1G52560

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:134 Identity:28/134 - (20%)
Similarity:50/134 - (37%) Gaps:32/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DVSQFKP--NELTVKVVDNTVV-------------------VEGKHEEREDGHGMIQRHFVRKYT 138
            |...|.|  ||.....:.||::                   :.|:.:|::|.:.:       :|.
plant    84 DHGYFTPTLNEFFPPTIGNTLIQATENMNRIFDNFNVNPFQLMGQVKEQDDCYKL-------RYE 141

  Fly   139 LPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAEN 203
            :| |....:|..|| :||:||:|......:|:...|...........:.:.....|:  |.|.|:
plant   142 VP-GLTKEDVKITV-NDGILTIKGDHKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPD--DAKVED 202

  Fly   204 GSGE 207
            ...|
plant   203 IKAE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 21/88 (24%)
AT1G52560NP_175665.1 ACD_sHsps-like 129..218 CDD:107221 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.