DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and HSP21

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:90 Identity:20/90 - (22%)
Similarity:43/90 - (47%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DVSQFKPNELTVKVVDNTVVVEG--KHEEREDG-HGMIQRHFVRKYTLPKGFDPNEVVSTVSSDG 156
            |:......::.:.|.||.:|::|  |.|:.:|. .|.....:..:..||...:.:::.:.: .:|
plant   143 DMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAEL-KNG 206

  Fly   157 VLTLKAPPPPSKEQAKSER-IVQIQ 180
            ||.:..|      :.|.|| ::.:|
plant   207 VLFITIP------KTKVERKVIDVQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 15/70 (21%)
HSP21NP_194497.1 HSP20 130..227 CDD:459629 20/90 (22%)

Return to query results.
Submit another query.