DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and HSP21

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:90 Identity:20/90 - (22%)
Similarity:43/90 - (47%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DVSQFKPNELTVKVVDNTVVVEG--KHEEREDG-HGMIQRHFVRKYTLPKGFDPNEVVSTVSSDG 156
            |:......::.:.|.||.:|::|  |.|:.:|. .|.....:..:..||...:.:::.:.: .:|
plant   143 DMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAEL-KNG 206

  Fly   157 VLTLKAPPPPSKEQAKSER-IVQIQ 180
            ||.:..|      :.|.|| ::.:|
plant   207 VLFITIP------KTKVERKVIDVQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 15/70 (21%)
HSP21NP_194497.1 IbpA 90..225 CDD:223149 19/88 (22%)
HSP20 130..227 CDD:278440 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.