DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb11

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001092897.1 Gene:hspb11 / 796767 ZFINID:ZDB-GENE-030131-5148 Length:205 Species:Danio rerio


Alignment Length:196 Identity:56/196 - (28%)
Similarity:89/196 - (45%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FH-PRRLLLPNTLGLGRRRYSPYERSHGHHNQ-----------MSRRASGGPNALLP-------- 83
            || |.|.|.|.|    |..:..:|:....|.|           :.:|.....:.:.|        
Zfish    17 FHWPVRSLWPET----RPLFFQFEQEMMRHMQEMRHNMEFMERLHQRIFDEIDHVSPMTTFKPIS 77

  Fly    84 -AVGKDG--FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER-EDGHGMIQ---RHFVRKYTLPK 141
             .:||:|  :.:.:|...|.|.||.||.|...:.|.||.|:: :||.|...   :.|.:::.||:
Zfish    78 FQLGKEGSHYALTLDTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEFRQEFDLPE 142

  Fly   142 GFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGSG 206
            |.:| |.||...::|.|.::|  |.......:||::.|..| ||   ||.||.:  :.:.||.:.
Zfish   143 GVNP-ESVSCSLNNGQLQIQA--PREGNTVSNERVIPITYT-PA---VKNPALQ--NSEPENQAV 198

  Fly   207 E 207
            |
Zfish   199 E 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 28/82 (34%)
hspb11NP_001092897.1 IbpA 36..177 CDD:223149 37/143 (26%)
ACD_HspB9_like 81..164 CDD:107236 29/85 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..205 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.