Sequence 1: | NP_001287001.1 | Gene: | Hsp27 / 39078 | FlyBaseID: | FBgn0001226 | Length: | 213 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092897.1 | Gene: | hspb11 / 796767 | ZFINID: | ZDB-GENE-030131-5148 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 56/196 - (28%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 FH-PRRLLLPNTLGLGRRRYSPYERSHGHHNQ-----------MSRRASGGPNALLP-------- 83
Fly 84 -AVGKDG--FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER-EDGHGMIQ---RHFVRKYTLPK 141
Fly 142 GFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGSG 206
Fly 207 E 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp27 | NP_001287001.1 | metazoan_ACD | 86..163 | CDD:107247 | 28/82 (34%) |
hspb11 | NP_001092897.1 | IbpA | 36..177 | CDD:223149 | 37/143 (26%) |
ACD_HspB9_like | 81..164 | CDD:107236 | 29/85 (34%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 184..205 | 6/18 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |