DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb3

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:103 Identity:33/103 - (32%)
Similarity:55/103 - (53%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RRASGGPNALL---------PAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHG 127
            |:|.|.|.||.         |..||..||:.:||.||.|.::.::..:..::::.:|..|.|.||
  Rat    46 RKARGTPKALAEDSDSAETPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHG 110

  Fly   128 MIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPP 165
            .|.|.|.|:|.||.|.:..::.:.:..||:|.::...|
  Rat   111 FISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 25/76 (33%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 6/20 (30%)
ACD_HspB3_Like 65..147 CDD:107232 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.