DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb9

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:164 Identity:42/164 - (25%)
Similarity:69/164 - (42%) Gaps:31/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YSPYERSHGHHNQMSR-----RASGGPNALLPA------VGKDG-----FQVCMDVSQFKPNELT 105
            :|..:|..|.:...||     .|.....|.||.      |..:|     ||:.:|...|.|.:|.
Mouse     8 FSTGQREPGENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPSFQIKVDAQGFAPEDLV 72

  Fly   106 VKVVDNTVVVEG--KHEEREDGHG--MIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTL----KA 162
            |::....:.|.|  :||..:...|  .:::...|:..||...||..:..:::..|.|.|    |.
Mouse    73 VRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQNKC 137

  Fly   163 PPPPSKEQAKSERIVQIQQTGP----AHLSVKAP 192
            .|||..:..:|::   .::.||    .:.|||.|
Mouse   138 LPPPEAQTGQSQK---PRRGGPKSSLQNESVKNP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 22/89 (25%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/16 (31%)
ACD_HspB9_like 50..135 CDD:107236 21/84 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.