DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb2

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:183 Identity:57/183 - (31%)
Similarity:83/183 - (45%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HAH------DLFHPRRLLLPNTLGLGRRRYS----PYE-----RSHGHH--NQMSRRASG---GP 78
            |||      :..:|.|        ||.:|:.    |.|     ..||::  .:.:|...|   |.
Mouse     8 HAHPATAEYEFANPSR--------LGEQRFGEGLLPEEILTPTLYHGYYVRPRAARAGEGARAGA 64

  Fly    79 NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGF 143
            :.|..:.||  ||..:|||.|.|:|:||:.|||.:.|..:|.:|.|.||.:.|.|.|.|.||...
Mouse    65 SELRLSEGK--FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADV 127

  Fly   144 DPNEVVSTVSSDGVLTLKAP--------------------PPPSKEQAKSERI 176
            ||..|.:.:|.||:|.|:||                    ||..:|:.:..|:
Mouse   128 DPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEIARV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 35/76 (46%)
Hspb2NP_077761.3 alpha-crystallin-Hsps_p23-like 67..148 CDD:381838 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.