DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb7

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:131 Identity:40/131 - (30%)
Similarity:61/131 - (46%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SPY-ERSHG------HHNQMSRRASGGPNAL-----LPAVGKDGFQVCMDVSQFKPNELTVKVVD 110
            :|| |:|.|      ......:.|.|.||..     :..:| |.:|..:||..|.|.::.|...:
Zfish    30 NPYMEKSRGLFADDFGSFMCPKDALGFPNRTGTVGNIKTLG-DTYQFTVDVQDFSPEDVIVTTSN 93

  Fly   111 NTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSK-EQAKSE 174
            |.:.|   |.|:....|.:...|..|..||:..||..|.|::.:||.||:||....:| |.|::.
Zfish    94 NQIEV---HAEKLASDGTVMNTFTHKCRLPEDVDPTSVKSSLGADGTLTIKAQRNTAKLEHAQTF 155

  Fly   175 R 175
            |
Zfish   156 R 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 26/76 (34%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 27/83 (33%)
IbpA <65..158 CDD:223149 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.