DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb8

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:161 Identity:52/161 - (32%)
Similarity:78/161 - (48%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDL-------FHPRRLLL---PNTLGLGRRRYSP--YERSHGHHNQMSRRASG 76
            ||::|||....:.||       ..||....   |...||.|....|  |          :.|.:|
 Frog    33 LLDEDFGIPPFSDDLTMDWPDWARPRLTSAWSGPLRSGLVRSGMPPPVY----------NSRYTG 87

  Fly    77 GPNALLPAVG-KDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLP 140
            .|:|...... ...::||::|..|||.|||||..|..|.|.|.|||::...|::.::|.:|:.||
 Frog    88 YPDARNTVANISQPWKVCVNVQTFKPEELTVKTKDGFVEVSGNHEEQQKEGGIVSKNFTKKFQLP 152

  Fly   141 KGFDPNEVVSTVSSDGVLTLKAP-PPPSKEQ 170
            ...|...|.:::|.:|:|.::|| .||..:|
 Frog   153 PEVDAQTVFASLSPEGLLIIEAPVVPPYNQQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 28/77 (36%)
hspb8NP_001005658.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 86..175 CDD:469641 31/88 (35%)

Return to query results.
Submit another query.