DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb8

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:161 Identity:52/161 - (32%)
Similarity:78/161 - (48%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDL-------FHPRRLLL---PNTLGLGRRRYSP--YERSHGHHNQMSRRASG 76
            ||::|||....:.||       ..||....   |...||.|....|  |          :.|.:|
 Frog    33 LLDEDFGIPPFSDDLTMDWPDWARPRLTSAWSGPLRSGLVRSGMPPPVY----------NSRYTG 87

  Fly    77 GPNALLPAVG-KDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLP 140
            .|:|...... ...::||::|..|||.|||||..|..|.|.|.|||::...|::.::|.:|:.||
 Frog    88 YPDARNTVANISQPWKVCVNVQTFKPEELTVKTKDGFVEVSGNHEEQQKEGGIVSKNFTKKFQLP 152

  Fly   141 KGFDPNEVVSTVSSDGVLTLKAP-PPPSKEQ 170
            ...|...|.:::|.:|:|.::|| .||..:|
 Frog   153 PEVDAQTVFASLSPEGLLIIEAPVVPPYNQQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 28/77 (36%)
hspb8NP_001005658.1 alpha-crystallin-Hsps_p23-like 86..175 CDD:381838 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.