DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hsp23

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:181 Identity:93/181 - (51%)
Similarity:115/181 - (63%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LLLPNTLGLGR-------------RRYSPYERSHGHHNQMSRR------ASGGPNALLPAVGKDG 89
            |||.....|||             |:.:||....|...|..|:      ||.|.:..:..:||||
  Fly     6 LLLSLADDLGRMSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDG 70

  Fly    90 FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSS 154
            ||||||||.|||:||.|||.||:|:|||.||||||.||.|.|||||:|.||.|::.::|.||:||
  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSS 135

  Fly   155 DGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGS 205
            |||||:|.|.||:.|...:||||||||.|||||:||....||.:  .:||:
  Fly   136 DGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVKENPKEAVE--QDNGN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 55/76 (72%)
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 55/77 (71%)
IbpA <69..161 CDD:223149 62/91 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452093
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.