DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hsp67Ba

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:283 Identity:106/283 - (37%)
Similarity:139/283 - (49%) Gaps:82/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIIP-LLHLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPN-TLGLGR--------- 54
            ||:|| :|.||.|| ||:.......::|..|||::..:....    ||. :.||||         
  Fly     1 MSLIPFILDLAEEL-HDFNRSLAMDIDDSAGFGLYPLEATSQ----LPQLSRGLGRGNAMMWVPI 60

  Fly    55 --------RRYSPYERSHGHHNQMSRRA--------------------SGGPNALLPA---VGKD 88
                    .|:.||.|..|.......::                    ||.|.|...|   |.::
  Fly    61 KGQSAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRN 125

  Fly    89 GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVS 153
            ||||.|:|.||..||||||.:||.:||||:|:|:|||||:|.|||:|||.||||:|||||.||:|
  Fly   126 GFQVSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLS 190

  Fly   154 SDGVLTLKAPPP-----PSKEQAKSERIVQIQQTG------------PAHLSVKA---------- 191
            |||:||:|||||     .|.|  :.||||.|||..            |:.:..:|          
  Fly   191 SDGILTVKAPPPLPVVKGSLE--RQERIVDIQQISQQQKDKDAQPPKPSEVEQQAAASATTSTLN 253

  Fly   192 -----PAPEAGDGKAE-NGSGEK 208
                 |.|......|| ||:|::
  Fly   254 PTAPTPTPSLSLTLAESNGNGQE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 52/76 (68%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 52/75 (69%)
DNA_pol3_delta2 <218..>381 CDD:331068 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452094
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.