DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb9

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:178 Identity:40/178 - (22%)
Similarity:64/178 - (35%) Gaps:57/178 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YSPYERSHGHHNQMSR----------RASGGPNALLPAVGKD-------------GFQVCMDVSQ 98
            :|..:|..|.:...||          :|:..|..||    ||             .||:.:|...
  Rat    42 FSTGQREPGENRVASRCPSVALSERNQAATLPVRLL----KDDLAAAHANGCEEPSFQMKLDAHG 102

  Fly    99 FKPNELTVKVVDNTVVVEGKHEERED----GHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLT 159
            |.|.:|.|::....::|.||.::..:    |...:::...|:..||...||..:..:::..|.|.
  Rat   103 FAPEDLVVRIDGQNLMVTGKRQQESNDPSRGRYRLEQSVHRQMQLPMTLDPAAMTCSLTPSGHLW 167

  Fly   160 LKA-----PPPPSKEQAKSERIVQIQQTGP--------AHLSVKAPAP 194
            .|.     |.|.:             ||||        ...|.|.|.|
  Rat   168 FKGQNKCLPLPEA-------------QTGPQTGQALRFKRGSSKCPNP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 21/98 (21%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.