DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and CG13133

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:223 Identity:70/223 - (31%)
Similarity:99/223 - (44%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DWGHLLEDDFGFGVHAHDLFH---PRRLLLPNTLGLGRRRYSPYERSH-------GHHNQMSRRA 74
            ||.|         .|.|...|   |||..   :.|..:.|...|..||       ..|.:|...|
  Fly     8 DWEH---------DHEHGHHHWQPPRRHW---STGESKCRQRHYYLSHDLDVCARDFHLRMDDSA 60

  Fly    75 SGGPNALL-----------PAVGKDGFQVCMDVSQFKPNELTVKVVD-NTVVVEGKH--EEREDG 125
            ....:.|:           .::|:..|:|.:||..|:.:|||||..: :||.||||.  :..|.|
  Fly    61 WCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKG 125

  Fly   126 HGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVK 190
            ...|.|.|.|.|.||:.:|..:..:|.|:||:|.:..|.||..:..  ||.::|:.||....||.
  Fly   126 QLCITREFTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDV--EREIEIEPTGNYFGSVS 188

  Fly   191 AP-APEA-------GDGKAENGSGEKME 210
            .| ||:|       |||...|.:|..|:
  Fly   189 DPTAPKAIEQADVDGDGGEANPAGTAMD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 32/79 (41%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.