powered by:
Protein Alignment Hsp27 and cryaba
DIOPT Version :9
Sequence 1: | NP_001287001.1 |
Gene: | Hsp27 / 39078 |
FlyBaseID: | FBgn0001226 |
Length: | 213 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571232.1 |
Gene: | cryaba / 30393 |
ZFINID: | ZDB-GENE-991119-2 |
Length: | 168 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 37/74 - (50%) |
Similarity: | 54/74 - (72%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 KDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVST 151
:|.|.:.:||..|.|:||||||.::.:.:.|||:||:|.||::.|.|.|||.:|.|.||..:.|:
Zfish 69 RDRFVINLDVKHFSPDELTVKVNEDFIEIHGKHDERQDDHGIVAREFFRKYKIPAGVDPGAITSS 133
Fly 152 VSSDGVLTL 160
:|||||||:
Zfish 134 LSSDGVLTI 142
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000383 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR45640 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X393 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.920 |
|
Return to query results.
Submit another query.