DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and HSPB8

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens


Alignment Length:165 Identity:55/165 - (33%)
Similarity:77/165 - (46%) Gaps:40/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDLFH-------PR-RLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNA 80
            ||:|.||......||..       || ....|.||..|                |..|   ||.|
Human    30 LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSG----------------MVPR---GPTA 75

  Fly    81 L----LPAVGK-------DGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFV 134
            .    :||.|:       :.::||::|..|||.||.||..|..|.|.|||||::...|::.::|.
Human    76 TARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT 140

  Fly   135 RKYTLPKGFDPNEVVSTVSSDGVLTLKAP--PPPS 167
            :|..||...||..|.:::|.:|:|.::||  ||.|
Human   141 KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 30/83 (36%)
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 33/89 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 55/165 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.