DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb1

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:131 Identity:52/131 - (39%)
Similarity:73/131 - (55%) Gaps:5/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFV 134
            ::|:.|.|.:.:....  |.::|.:||:.|.|.|||||..:..|.:.||||||:|.||.|.|.|.
  Rat    81 LNRQLSSGVSEIRQTA--DRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFT 143

  Fly   135 RKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDG 199
            ||||||.|.||..|.|::|.:|.||::||.|.:..|:..   :.|..|..|...:..|..|....
  Rat   144 RKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAE---ITIPVTFEARAQIGGPESEQSGA 205

  Fly   200 K 200
            |
  Rat   206 K 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 39/76 (51%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 51/129 (40%)
ACD_HspB1_like 88..173 CDD:107230 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.