DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb6

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001012401.1 Gene:Hspb6 / 243912 MGIID:2685325 Length:162 Species:Mus musculus


Alignment Length:156 Identity:58/156 - (37%)
Similarity:77/156 - (49%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPA-- 84
            |.|.:..||.|:...:|    ..|.|..:       :||          ..||   |:..||.  
Mouse    26 GRLFDQRFGEGLLEAEL----ASLCPAAI-------APY----------YLRA---PSVALPTAQ 66

  Fly    85 VGKDG--FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNE 147
            |..|.  |.|.:||..|.|.|::|||||:.|.|..:||||.|.||.|.|.|.|:|.||.|.||..
Mouse    67 VSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAA 131

  Fly   148 VVSTVSSDGVLTLKAPPPPSKEQAKS 173
            |.|.:|.:|||:::|.|..::.|..|
Mouse   132 VTSALSPEGVLSIQATPASAQAQLPS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 38/78 (49%)
Hspb6NP_001012401.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 17/69 (25%)
Crystallin 5..56 CDD:278926 10/50 (20%)
ACD_HspB4-5-6 66..148 CDD:107233 40/81 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.