DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Cryaa

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:183 Identity:55/183 - (30%)
Similarity:81/183 - (44%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERS----------------------HGH 66
            |.:..||.|:..:||..    .|.:|:       |||.|.                      |..
  Rat    22 LFDQFFGEGLFEYDLLP----FLSSTI-------SPYYRQSLFRTVLDSGISELMTHMWFVMHQP 75

  Fly    67 HNQMSRRASGGP--NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMI 129
            |       :|.|  |.......:|.|.:.:||..|.|.:|||||:::.|.:.|||.||:|.||.|
  Rat    76 H-------AGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYI 133

  Fly   130 QRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPS-KEQAKSERIVQIQQ 181
            .|.|.|:|.||...|.:.:..::|:||:||...|...| .:...|||.:.:.:
  Rat   134 SREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 33/76 (43%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 12/39 (31%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.