DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb6

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:161 Identity:59/161 - (36%)
Similarity:76/161 - (47%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPA-- 84
            |.|.:..||.|:...:|    ..|.|..:       :||          ..||   |:..||.  
  Rat    26 GRLFDQRFGEGLLEAEL----ASLCPAAI-------APY----------YLRA---PSVALPTAQ 66

  Fly    85 VGKDG--FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNE 147
            |..|.  |.|.:||..|.|.|::||||.:.|.|..:||||.|.||.|.|.|.|:|.||.|.||..
  Rat    67 VPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAA 131

  Fly   148 VVSTVSSDGVLTLKAPPP------PSKEQAK 172
            |.|.:|.:|||:::|.|.      ||...||
  Rat   132 VTSALSPEGVLSIQATPASAQASLPSPPAAK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 37/78 (47%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 17/69 (25%)
Crystallin 3..58 CDD:395419 12/55 (22%)
ACD_HspB4-5-6 66..148 CDD:107233 39/81 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.