DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and ZK1128.7

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:96 Identity:32/96 - (33%)
Similarity:51/96 - (53%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SRRASGGPNALLPAVGK-----DGFQVCMDVSQFKPNELTVKVVDNTVVVEG-KHEEREDGHGMI 129
            ||..|.||.|   ..|:     .||.:.:||..|.|.|:.|.:.|:|:.:.| :.|...||| .:
 Worm    83 SRPRSPGPVA---GAGEITNTSHGFTIEIDVFHFMPEEIKVVLTDDTLSISGERFESTGDGH-TL 143

  Fly   130 QRHFVRKYTLPKGFDPNEVVSTVSSDGVLTL 160
            :|.|.|||::|.....:.:.|.:::.|||.:
 Worm   144 RRSFSRKYSIPDDVHLDTIRSHLTNSGVLII 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 26/81 (32%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 25/80 (31%)

Return to query results.
Submit another query.