DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hsp-25

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:144 Identity:44/144 - (30%)
Similarity:74/144 - (51%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGRRRYSPYERSHGHHNQMSRRASG-----------GPNALL---------------PAV--GKD 88
            :..:.|:.|..:..|| :.|.|..|           ||:.|:               |.:  ..|
 Worm    72 ISNQPYNAYSNTSSHH-ETSNRTGGFGSPLPPPSFHGPSDLMAHRPTYDPYLDNLKSPLIKDESD 135

  Fly    89 G--FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVST 151
            |  .::..||:.:||.|:|||.:||.::|..||||:.. ...:.|.:.:::.||:|.:|.::.||
 Worm   136 GKTLRLRFDVANYKPEEVTVKTIDNRLLVHAKHEEKTP-QRTVFREYNQEFLLPRGTNPEQISST 199

  Fly   152 VSSDGVLTLKAPPP 165
            :|:|||||::||.|
 Worm   200 LSTDGVLTVEAPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 30/78 (38%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.