DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hsp-16.1

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_505354.1 Gene:hsp-16.1 / 179286 WormBaseID:WBGene00002015 Length:145 Species:Caenorhabditis elegans


Alignment Length:118 Identity:39/118 - (33%)
Similarity:64/118 - (54%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QMSRR----ASGGPNALLPAVGKD-GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGM 128
            ||.|:    ..|.|:.....|..| .|.:.::||||||.:|.:.:..:|:.::|:.|.:.: ||.
 Worm    24 QMERQFTPVCRGSPSESSEIVNNDQKFAINLNVSQFKPEDLKINLDGHTLSIQGEQELKTE-HGY 87

  Fly   129 IQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQ 181
            .::.|.|...||:..|...|.|.:|.||.|:::||    |::|...|.:.|||
 Worm    88 SKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAP----KKEAIQGRSIPIQQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 25/77 (32%)
hsp-16.1NP_505354.1 IbpA 17..134 CDD:223149 36/114 (32%)
metazoan_ACD 42..123 CDD:107247 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.