DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hsp-16.2

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001379929.1 Gene:hsp-16.2 / 178659 WormBaseID:WBGene00002016 Length:145 Species:Caenorhabditis elegans


Alignment Length:126 Identity:39/126 - (30%)
Similarity:61/126 - (48%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RYSPYERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHE 120
            |.||.|.|...:|...                  |.:.::||||||.:|.:.:...|:.::|:.|
 Worm    34 RISPSESSEIVNNDQK------------------FAINLNVSQFKPEDLKINLDGRTLSIQGEQE 80

  Fly   121 EREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQ 181
            .:.| ||..::.|.|...||:..|...|.|.:|.||.|:::||    |::|...|.:.|||
 Worm    81 LKTD-HGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAP----KKEAVQGRSIPIQQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 25/76 (33%)
hsp-16.2NP_001379929.1 metazoan_ACD 42..123 CDD:107247 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160426
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.