DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Hspb2

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:183 Identity:57/183 - (31%)
Similarity:83/183 - (45%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HAH------DLFHPRRLLLPNTLGLGRRRYS----PYE-----RSHGHH--NQMSRRASG---GP 78
            |||      :..:|.|        ||.:|:.    |.|     ..||::  .:.:|...|   |.
  Rat     8 HAHPATAEYEFANPSR--------LGEQRFGEGLLPEEILTPTLYHGYYVRPRAARAGEGGRAGA 64

  Fly    79 NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGF 143
            :.|..:.||  ||..:|||.|.|:|:||:.|||.:.|..:|.:|.|.||.:.|.|.|.|.||...
  Rat    65 SELRLSEGK--FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADV 127

  Fly   144 DPNEVVSTVSSDGVLTLKAP--------------------PPPSKEQAKSERI 176
            ||..|.:.:|.||:|.|:||                    ||..:|:.:..|:
  Rat   128 DPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEVARV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 35/76 (46%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419 9/42 (21%)
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 37/82 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.