DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and CRYAB

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:177 Identity:62/177 - (35%)
Similarity:80/177 - (45%) Gaps:53/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSP-YERSHGHHNQMSRRASGGPNALLPA-- 84
            ||||.|                |.|.:..|     || |.|               |.:.|.|  
Human    31 HLLESD----------------LFPTSTSL-----SPFYLR---------------PPSFLRAPS 59

  Fly    85 ----------VGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTL 139
                      :.||.|.|.:||..|.|.||.|||:.:.:.|.||||||:|.||.|.|.|.|||.:
Human    60 WFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRI 124

  Fly   140 PKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQI-QQTGPA 185
            |...||..:.|::|||||||:..   |.|:.:..||.:.| ::..||
Human   125 PADVDPLTITSSLSSDGVLTVNG---PRKQVSGPERTIPITREEKPA 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 40/76 (53%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419 12/56 (21%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 41/85 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.