DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and CRYAA

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens


Alignment Length:159 Identity:50/159 - (31%)
Similarity:76/159 - (47%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPAVGKD 88
            |.:..||.|:..:||..    .|.:|:       |||.|.......:....|...:      .:|
Human    22 LFDQFFGEGLFEYDLLP----FLSSTI-------SPYYRQSLFRTVLDSGISEVRS------DRD 69

  Fly    89 GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVS 153
            .|.:.:||..|.|.:|||||.|:.|.:.|||.||:|.||.|.|.|.|:|.||...|.:.:..::|
Human    70 KFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLS 134

  Fly   154 SDGVLTLKAPP-PPSKEQAKSERIVQIQQ 181
            :||:||...|. ....:...:||.:.:.:
Human   135 ADGMLTFCGPKIQTGLDATHAERAIPVSR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 34/76 (45%)
CRYAANP_000385.1 Crystallin 1..51 CDD:395419 12/39 (31%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.