DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and Cryab

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:185 Identity:64/185 - (34%)
Similarity:87/185 - (47%) Gaps:42/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LFHP--RRLLLPNTLGLGRRRYSP---YERSHGHH----NQMSRRASGGPNALLP---------- 83
            :.||  ||...|        .:||   :::..|.|    :..|...|..|..|.|          
Mouse     5 IHHPWIRRPFFP--------FHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWI 61

  Fly    84 -------AVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPK 141
                   .:.||.|.|.:||..|.|.||.|||:.:.:.|.||||||:|.||.|.|.|.|||.:|.
Mouse    62 DTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPA 126

  Fly   142 GFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQI-QQTGPAHLSVKAPAPE 195
            ..||..:.|::|||||||:..   |.|:.:..||.:.| ::..||    .|.||:
Mouse   127 DVDPLTITSSLSSDGVLTVNG---PRKQVSGPERTIPITREEKPA----VAAAPK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 40/76 (53%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419 13/54 (24%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 41/85 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.