DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and HSPB6

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_653218.1 Gene:HSPB6 / 126393 HGNCID:26511 Length:160 Species:Homo sapiens


Alignment Length:179 Identity:61/179 - (34%)
Similarity:77/179 - (43%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPA-- 84
            |.|.:..||.|:...:|    ..|.|.||       :||          ..||   |:..||.  
Human    26 GRLFDQRFGEGLLEAEL----AALCPTTL-------APY----------YLRA---PSVALPVAQ 66

  Fly    85 VGKD--GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNE 147
            |..|  .|.|.:||..|.|.|:.||||...|.|..:||||.|.||.:.|.|.|:|.||.|.||..
Human    67 VPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAA 131

  Fly   148 VVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEA 196
            |.|.:|.:|||:::|.|                      .|.:||.|.|
Human   132 VTSALSPEGVLSIQAAP----------------------ASAQAPPPAA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 36/78 (46%)
HSPB6NP_653218.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269|PubMed:27717639 1..72 19/69 (28%)
Crystallin 3..58 CDD:395419 14/55 (25%)
ACD_HspB4-5-6 66..144 CDD:107233 37/77 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.