DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb2

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 / 100497635 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis


Alignment Length:180 Identity:55/180 - (30%)
Similarity:84/180 - (46%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHH-----NQMSRRASGGPNALLP 83
            :.:.:||.|:...||..|       ||            .||::     |:.:.|.....|.   
 Frog    24 IFDQNFGEGISPEDLLCP-------TL------------YHGYYIRPRINKQTDRGFSEINR--- 66

  Fly    84 AVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEV 148
              .:..|||.:||..|.|:|::|..:||.:.|..||.::.|.||.:.|.|.|||.||...||..|
 Frog    67 --NEHKFQVFLDVCHFLPDEISVHTMDNLLEVSAKHPQKIDSHGFVSRSFNRKYILPLDVDPLLV 129

  Fly   149 VSTVSSDGVLTLKAPPPPSKE-QAKSE-RIVQIQQTGPAHLSVKAPAPEA 196
            .:.:|.||:|:::|   |.|| ..|.| .:|:|:..       ::|..||
 Frog   130 KAKLSHDGILSIEA---PRKEVDLKGENNVVKIKVQ-------RSPVAEA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 31/76 (41%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:278926 10/45 (22%)
IbpA <63..149 CDD:223149 36/93 (39%)
alpha-crystallin-Hsps_p23-like 69..145 CDD:294116 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.