DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb6

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:156 Identity:55/156 - (35%)
Similarity:80/156 - (51%) Gaps:16/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPAVGKD 88
            :|...||.||...:||.    .:|..:.|     |||   :.....:.:.:..|.:.:  .:.||
 Frog    24 ILGQRFGEGVLESELFP----AMPMPMAL-----SPY---YYRSPSIPQPSEAGLSEV--KLDKD 74

  Fly    89 GFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVS 153
            .|.|.:||..|.|.|||||||.:.|.|..|||||.|.||.|.|.|.|:|.:|....|..:.|.:|
 Frog    75 QFSVLLDVKHFSPEELTVKVVGDYVEVHAKHEERPDEHGFISREFHRRYKIPPTVSPAAISSALS 139

  Fly   154 SDGVLTLKAPPPPSKEQAKSERIVQI 179
            ::|:|:::||.....:|  .||.:.|
 Frog   140 AEGLLSIQAPVTAGGKQ--EERSIPI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 36/76 (47%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 12/43 (28%)
ACD_HspB4-5-6 68..149 CDD:107233 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.