DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hsp30c

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002944274.2 Gene:hsp30c / 100493630 XenbaseID:XB-GENE-5764040 Length:215 Species:Xenopus tropicalis


Alignment Length:141 Identity:50/141 - (35%)
Similarity:75/141 - (53%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PAVGKDG---FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER---EDGHGMIQ-RHFVRKYTLP 140
            |:.||||   |::.:||..|.|:|||||:....|:|.||||.:   |||..:.: |.:.|:..||
 Frog    86 PSSGKDGKDHFELTLDVRDFSPHELTVKMQGRRVIVTGKHERKSDSEDGSYVHEYRQWKREAELP 150

  Fly   141 KGFDPNEVVSTVSSDGVLTLKAPP---PPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAG----- 197
            :|.:|.:||.::|.||.|.::||.   ||:.|:             |..:|:. |||...     
 Frog   151 EGVNPEQVVCSLSKDGHLHIQAPRLALPPAPER-------------PIPISMD-PAPRDAQEIPP 201

  Fly   198 DGKAENGSGEK 208
            |.:..|..||:
 Frog   202 DAQNSNADGEQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 35/83 (42%)
hsp30cXP_002944274.2 ACD_HspB9_like 88..174 CDD:107236 36/85 (42%)

Return to query results.
Submit another query.