DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hsp30d

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d / 100489362 XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis


Alignment Length:141 Identity:49/141 - (34%)
Similarity:72/141 - (51%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PAVGKDG---FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER---EDGHGMIQ-RHFVRKYTLP 140
            |:.||||   |::.:||..|.|:|||||:....|:|.||.|.:   |||....: |.:.|:..||
 Frog    86 PSSGKDGKDHFELTLDVRDFSPHELTVKMQGRRVIVTGKQERKSDSEDGSYFHEYREWKREAELP 150

  Fly   141 KGFDPNEVVSTVSSDGVLTLKAPP---PPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAG----- 197
            :|.:|.:||.:.|.||.|.::||.   ||:.|:             |..:|:. |||...     
 Frog   151 EGVNPEQVVCSFSKDGHLHIQAPRLALPPAPER-------------PIPISMD-PAPRDAQEIPP 201

  Fly   198 DGKAENGSGEK 208
            |.:..|..||:
 Frog   202 DAQNSNADGEQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 34/83 (41%)
hsp30dXP_002937646.1 ACD_HspB9_like 88..174 CDD:107236 35/85 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.