DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and LOC100489207

DIOPT Version :9

Sequence 1:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_012822866.2 Gene:LOC100489207 / 100489207 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:129 Identity:44/129 - (34%)
Similarity:66/129 - (51%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEER---EDGHGMIQ-RHFVRKYTLPKGFDPN 146
            |||.|::.:||..|.|:|:|||.....|:|.||||.:   |||..:.: |.:.|:..||:|.:..
 Frog    86 GKDHFELMLDVGDFSPHEITVKTQGRRVIVTGKHERKSDSEDGSYVHEYREWNRRAELPEGVNLE 150

  Fly   147 EVVSTVSSDGVLTLKAP---PPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGSGE 207
            :||.::|.||.|.:|||   .||:.|:             |..:|:.. ||....... |.:.|
 Frog   151 QVVCSLSKDGHLHIKAPWLALPPAPER-------------PIPISMNM-APSVAQPMPXNSNAE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 33/80 (41%)
LOC100489207XP_012822866.2 ACD_HspB9_like 82..167 CDD:107236 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.