DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and hspb3

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:74 Identity:26/74 - (35%)
Similarity:45/74 - (60%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTV 152
            |.|:|.:||.||:|.::.::|.:..::::|:|..|.|.||.|.|.|.|.|.||.|....::.:..
 Frog    61 DKFKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFF 125

  Fly   153 SSDGVLTLK 161
            ..||:|.::
 Frog   126 CHDGILAVE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 26/74 (35%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 26/74 (35%)

Return to query results.
Submit another query.