DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp27 and cryaa

DIOPT Version :10

Sequence 1:NP_524000.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:192 Identity:60/192 - (31%)
Similarity:88/192 - (45%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRTDWGH---LLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGP 78
            :|...|:   |.:..||.|:..:|||       |.|..    ..|||.|.....|.:....||..
Zfish    10 FRRTLGYPTRLFDQFFGEGLFDYDLF-------PFTTS----TVSPYYRHSLFRNILDSSNSGVS 63

  Fly    79 NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGF 143
            ..   ...::.|.|.:||..|.|:||:|||.|:.|.::|||.||:|.||.|.|.|.|:|.||...
Zfish    64 EV---RSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNV 125

  Fly   144 DPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGS 205
            |.:.:..|:|:||:|||..|.....:..:.:|.:                |...:.|:.:||
Zfish   126 DQSAITCTLSADGLLTLCGPKTSGIDAGRGDRTI----------------PVTREDKSNSGS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp27NP_524000.1 metazoan_ACD 86..163 CDD:107247 36/76 (47%)
cryaaNP_694482.1 Crystallin 1..52 CDD:425732 15/52 (29%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..146 CDD:469641 37/87 (43%)

Return to query results.
Submit another query.