DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSPB9

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 / 94086 HGNCID:30589 Length:159 Species:Homo sapiens


Alignment Length:78 Identity:22/78 - (28%)
Similarity:35/78 - (44%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHF---VRRYALPPGYEADKV 129
            :||||:.:|...|.|.||||:|....::|.|..:....|...::...   |.|..||.......:
Human    51 RDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAM 115

  Fly   130 ASTLSSDGVLTIK 142
            ...|:..|.|.::
Human   116 TCCLTPSGQLWVR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 22/78 (28%)
IbpA <69..161 CDD:223149 22/77 (29%)
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.