DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSP26

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_009628.1 Gene:HSP26 / 852364 SGDID:S000000276 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:30/107 - (28%)
Similarity:53/107 - (49%) Gaps:19/107 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GAVSKIGKDGFQVCMDVS-HFKPSELVVKVQDNSVLVEGNHEE---REDDHGFITRHFVRRYALP 121
            |..||  ||     :|:. |...::::|..:..|.|.|.:.::   :|...|    .|.|...||
Yeast   112 GVKSK--KD-----IDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSG----KFKRVITLP 165

  Fly   122 --PGYEADKVASTLSSDGVLTIKVPK-PPAIEDKGNERIVQI 160
              ||.:||.:.:.. ::||||:.||| .|..:.|.:.:.:::
Yeast   166 DYPGVDADNIKADY-ANGVLTLTVPKLKPQKDGKNHVKKIEV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 23/83 (28%)
IbpA <69..161 CDD:223149 26/99 (26%)
HSP26NP_009628.1 IbpA 72..205 CDD:223149 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.