DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT1G59860

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:124 Identity:34/124 - (27%)
Similarity:61/124 - (49%) Gaps:15/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KQVGASSGSSGAVSKIGKDGFQVC------MDVSHFKPSELVVKVQDNSVL-VEGNH----EERE 104
            |::...|.||.|::....|..:..      .|:...|..|:.|:::|:||| :.|..    ||::
plant    31 KELQFPSSSSSAIANARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQ 95

  Fly   105 DDHGFITRH---FVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQI 160
            |....:.|.   |.|::.||...:.|:|.::: .:||||:.|||....:.|...:.:.|
plant    96 DTWHRVERSSGGFSRKFRLPENVKMDQVKASM-ENGVLTVTVPKVETNKKKAQVKSIDI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/91 (27%)
IbpA <69..161 CDD:223149 29/106 (27%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.