DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT1G52560

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:157 Identity:26/157 - (16%)
Similarity:61/157 - (38%) Gaps:58/157 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVE 97
            ||: .|:|.:::|                      .|.:::..:|......::.:.|.|..:.::
plant   121 NPF-QLMGQVKEQ----------------------DDCYKLRYEVPGLTKEDVKITVNDGILTIK 162

  Fly    98 GNH---EER---EDDHGFITR---HFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKG 153
            |:|   ||:   |:|..:.::   ::....:||...:.:.:.:.| .:|||.:.:|:        
plant   163 GDHKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDAKVEDIKAEL-KNGVLNLVIPR-------- 218

  Fly   154 NERIVQIQQVGPAHLNVKENPKEAVEQ 180
                             .|.||:.|::
plant   219 -----------------TEKPKKNVQE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 16/86 (19%)
IbpA <69..161 CDD:223149 17/100 (17%)
AT1G52560NP_175665.1 ACD_sHsps-like 129..218 CDD:107221 17/111 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.