DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT1G07400

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:161 Identity:39/161 - (24%)
Similarity:76/161 - (47%) Gaps:23/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQV---GASSGSSGAVSKIGKDGFQVC---- 74
            ||::|.:  :...|:.|   ::..|....:....|::   .:.||.:.|::....|..:..    
plant     1 MSLIPSF--FGNNRRSN---SIFDPFSLDVWDPFKELQFPSSLSGETSAITNARVDWKETAEAHV 60

  Fly    75 --MDVSHFKPSELVVKVQDNSVL-VEGNH----EEREDDHGFITR---HFVRRYALPPGYEADKV 129
              .|:...|..|:.|:::|:||| :.|..    ||::|....:.|   .|.|::.||...:.|:|
plant    61 FKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMDQV 125

  Fly   130 ASTLSSDGVLTIKVPKPPAIEDKGNERIVQI 160
            .::: .:||||:.|||....:.|...:.:.|
plant   126 KASM-ENGVLTVTVPKVEEAKKKAQVKSIDI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 25/91 (27%)
IbpA <69..161 CDD:223149 29/106 (27%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.