DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT5G51440

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_199957.1 Gene:AT5G51440 / 835218 AraportID:AT5G51440 Length:210 Species:Arabidopsis thaliana


Alignment Length:121 Identity:32/121 - (26%)
Similarity:57/121 - (47%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLV--EGNHEEREDDHGFITRHFV 115
            :|||....|...|...|...:.:|:......::.:.::.|::::  ||..||.||..| ..|.|.
plant   102 MGASGVRRGWNVKEKDDALHLRIDMPGLSREDVKLALEQNTLVIRGEGETEEGEDVSG-DGRRFT 165

  Fly   116 RRYALPPG-YEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNV 170
            .|..||.. |:.|::.:.: .:|||.:.:||... :::.|.|          |:||
plant   166 SRIELPEKVYKTDEIKAEM-KNGVLKVVIPKIKE-DERNNIR----------HINV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 20/80 (25%)
IbpA <69..161 CDD:223149 24/94 (26%)
AT5G51440NP_199957.1 ACD_sHsps-like 112..195 CDD:107221 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.