DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSP17.6A

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:102 Identity:27/102 - (26%)
Similarity:52/102 - (50%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHG----FITRH-----FVRRYALPPGY 124
            |.:...:|:...|..|:.|::::.:|||.....:|::...    |:...     |:|::.||...
plant    55 DAYVFAVDMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPDNA 119

  Fly   125 EADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQ 161
            :.:|: |...:||||.:.:||.|..|.| ..:.:|:|
plant   120 DLEKI-SAACNDGVLKVTIPKLPPPEPK-KPKTIQVQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 20/84 (24%)
IbpA <69..161 CDD:223149 26/100 (26%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:365807 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.