DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSP17.6II

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:165 Identity:40/165 - (24%)
Similarity:73/165 - (44%) Gaps:29/165 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DLGRM-------SMVPFYEPYYCQRQRNPYLALVGPMEQQLRQLEKQVGASSGSSGAVSKIGKDG 70
            ||||.       .|:...|.:..::.||      .|....:|..:    |.:.:...|.: ..:.
plant     2 DLGRFPIISILEDMLEVPEDHNNEKTRN------NPSRVYMRDAK----AMAATPADVIE-HPNA 55

  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRH---------FVRRYALPPGYEA 126
            :...:|:...|..|:.|:|::::|||.....:||:......::         |:|::.||...:.
plant    56 YAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADL 120

  Fly   127 DKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQ 161
            ||: |.:..||||.:.|.|.|..|.| ..:.:|:|
plant   121 DKI-SAVCHDGVLKVTVQKLPPPEPK-KPKTIQVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 22/86 (26%)
IbpA <69..161 CDD:223149 27/100 (27%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:365807 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.