DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and HSP23.6-MITO

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_194250.1 Gene:HSP23.6-MITO / 828623 AraportID:AT4G25200 Length:210 Species:Arabidopsis thaliana


Alignment Length:164 Identity:40/164 - (24%)
Similarity:76/164 - (46%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DLGRMSMVP---------FYEPYYCQRQRNPYLALVGP-MEQQLRQLEKQVGASSGSSGAVSKIG 67
            ||.|.| ||         .::|:...|..:..|.|:.. ||..|....:.:|||....|...|..
plant    51 DLYRRS-VPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEK 114

  Fly    68 KDGFQVCMDVSHFKPSELVVKVQDNSVLV--EGNHEE---REDDHGFITRHFVRRYALPPG-YEA 126
            .|...:.:|:......::.:.::.:::::  ||.:||   .|.:.|  .|.|..|..||.. |:.
plant   115 DDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESG--NRRFTSRIGLPDKIYKI 177

  Fly   127 DKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQI 160
            |::.:.: .:|||.:.:||... :::.:.|.::|
plant   178 DEIKAEM-KNGVLKVVIPKMKE-QERNDVRQIEI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 18/83 (22%)
IbpA <69..161 CDD:223149 22/98 (22%)
HSP23.6-MITONP_194250.1 ACD_sHsps-like 110..195 CDD:107221 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.