DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and AT4G21870

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_193918.1 Gene:AT4G21870 / 828276 AraportID:AT4G21870 Length:134 Species:Arabidopsis thaliana


Alignment Length:110 Identity:26/110 - (23%)
Similarity:43/110 - (39%) Gaps:35/110 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DGFQVCMDVSHFKPSELVVKVQDNSVLV---EGNHEEREDDHGFITRHFVRRYALP--------- 121
            |.....:|:...:..|:.|:::|:..|:   |.......|..   .:.|.|::.||         
plant    35 DSHTFSVDLPGLRKEEIKVEIEDSIYLIIRTEATPMSPPDQP---LKTFKRKFRLPESIDMIGIS 96

  Fly   122 PGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPA 166
            .|||          |||||:.|||          ||:..:.:.|:
plant    97 AGYE----------DGVLTVIVPK----------RIMTRRLIDPS 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 21/87 (24%)
IbpA <69..161 CDD:223149 25/103 (24%)
AT4G21870NP_193918.1 alpha-crystallin-Hsps_p23-like 27..110 CDD:412199 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.