DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and ATHSP22.0

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_192763.1 Gene:ATHSP22.0 / 826616 AraportID:AT4G10250 Length:195 Species:Arabidopsis thaliana


Alignment Length:122 Identity:35/122 - (28%)
Similarity:60/122 - (49%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VGASSGSSGAVS------KIGKDGFQVCMDVSHFKPSELVVKVQDNSVL-VEGNHEEREDDHG-- 108
            :|....:|.|:|      |...:|.::.:|:...|..|:.::|::|.|| |.|..:..|:..|  
plant    58 LGLERDTSVALSPARVDWKETAEGHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKKGDQ 122

  Fly   109 --FITR---HFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQI 160
              .:.|   .|.|::.||...:.:.|.:.| .:|||||.:.|....:.|| .|:|.|
plant   123 WHRVERSYGKFWRQFKLPDNVDMESVKAKL-ENGVLTINLTKLSPEKVKG-PRVVNI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 24/85 (28%)
IbpA <69..161 CDD:223149 30/100 (30%)
ATHSP22.0NP_192763.1 IbpA 42..177 CDD:223149 34/120 (28%)
ACD_ScHsp26_like 72..163 CDD:107229 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.