DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb8

DIOPT Version :10

Sequence 1:NP_523999.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_109629.1 Gene:Hspb8 / 80888 MGIID:2135756 Length:196 Species:Mus musculus


Alignment Length:96 Identity:33/96 - (34%)
Similarity:56/96 - (58%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 FQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSS 135
            ::||::|..|||.||:||.:|..|.|.|.|||::.:.|.::::|.::..||...:...|.::||.
Mouse    96 WKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPATVFASLSP 160

  Fly   136 DGVLTIKVPKPPAI----EDKGNERIVQIQQ 162
            :|:|.|:.|:.|..    |...|..:.|..|
Mouse   161 EGLLIIEAPQVPPYSPFGESSFNNELPQDNQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_523999.1 metazoan_ACD 67..145 CDD:107247 27/73 (37%)
Hspb8NP_109629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 27/73 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.