DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and hspb6

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001094428.1 Gene:hspb6 / 792610 ZFINID:ZDB-GENE-080214-7 Length:142 Species:Danio rerio


Alignment Length:119 Identity:45/119 - (37%)
Similarity:64/119 - (53%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VGPME----QQLRQLEKQVGASSGSSGAVSKIGKD--GFQVCMDVSHFKPSELVVKVQDNSVLVE 97
            :||..    :.|..:.:|.||        ||:..|  ||.|.:||.||.|.||:|||..:.|:||
Zfish    31 IGPYSWTPTEFLIPVTEQTGA--------SKVTCDHNGFTVEVDVKHFSPEELLVKVSGDYVVVE 87

  Fly    98 GNHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIED 151
            |.||:::|..|.:||.|.|||.:|.|.....:.|.:|.:|:|.|..|....|.:
Zfish    88 GKHEQKKDGSGLVTRQFNRRYRIPNGVNIMALESAMSPEGMLVISAPLTQTIPE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 35/79 (44%)
IbpA <69..161 CDD:223149 37/85 (44%)
hspb6NP_001094428.1 metazoan_ACD 53..135 CDD:107247 36/81 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.