DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp23 and Hspb3

DIOPT Version :9

Sequence 1:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:119 Identity:41/119 - (34%)
Similarity:66/119 - (55%) Gaps:5/119 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ALVGPMEQQLRQLE---KQVGASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEG 98
            ||.||..:.||:..   |.:...|.|:......||..||:.:||..|.|.:::::..:..:|::.
  Rat    36 ALPGPTIEDLRKARGTPKALAEDSDSAETPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKA 100

  Fly    99 NHEEREDDHGFITRHFVRRYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDK 152
            .|..|.|:||||:|.|.|:|.||.|.|...:::.|..||:|.::|..|  :|.|
  Rat   101 QHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDP--LETK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 29/77 (38%)
IbpA <69..161 CDD:223149 30/84 (36%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 3/20 (15%)
ACD_HspB3_Like 65..147 CDD:107232 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.